PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_316475g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 215aa    MW: 24610.8 Da    PI: 8.7974
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_316475g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.49.1e-101451148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEde+l+ +++ +G g          + R++k+c++rw +yl
   MA_316475g0010 14 KGAWSKEEDEILIAYIQAHGEG----------LQRCGKSCRLRWINYL 51
                     79******************99..........46************97 PP

2Myb_DNA-binding60.92.6e-1972117148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eEdel+++++ +lG++ W++Ia++++ gRt++++k++w++++
   MA_316475g0010  72 RGNFSQEEDELIIKLHSMLGNK-WSLIASKLP-GRTDNEIKNYWNTHM 117
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-12552IPR009057Homeodomain-like
PROSITE profilePS5129411.793955IPR017930Myb domain
SuperFamilySSF466892.55E-9951IPR009057Homeodomain-like
SMARTSM007172.5E-61368IPR001005SANT/Myb domain
PfamPF002498.6E-81451IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-125379IPR009057Homeodomain-like
SuperFamilySSF466895.2E-2353122IPR009057Homeodomain-like
PROSITE profilePS5129429.17167121IPR017930Myb domain
SMARTSM007172.1E-1871119IPR001005SANT/Myb domain
PfamPF002492.3E-1772116IPR001005SANT/Myb domain
CDDcd001677.76E-1374117No hitNo description
Gene3DG3DSA:1.10.10.607.6E-2580118IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MGRSPCCEKT HTNKGAWSKE EDEILIAYIQ AHGEGLQRCG KSCRLRWINY LQRCGKSCRL  60
RWINYLRPDL KRGNFSQEED ELIIKLHSML GNKWSLIASK LPGRTDNEIK NYWNTHMKRK  120
LSAIRGVDPY NTHPDHGSSF QSSSEYIHVL PKRRCKPNEV CTDFFQQQQQ ITPGTTWSEQ  180
KVISTGHEDV NLELSITLPS LCSEVQGASS NSSKG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-271312126128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010431803.11e-70PREDICTED: transcription repressor MYB4-like
SwissprotQ9SZP12e-70MYB4_ARATH; Transcription repressor MYB4
TrEMBLA0A087GKR16e-70A0A087GKR1_ARAAL; Uncharacterized protein
TrEMBLA5JYF42e-70A5JYF4_PICGL; R2R3-MYB transcription factor MYB10
STRINGAT4G38620.15e-68(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.11e-71myb domain protein 4